General Information

  • ID:  hor006664
  • Uniprot ID:  Q28469
  • Protein name:  Endothelin-1
  • Gene name:  EDN1
  • Organism:  Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
  • Family:  Endothelin/sarafotoxin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0019229 regulation of vasoconstriction; GO:0042310 vasoconstriction; GO:0086100 endothelin receptor signaling pathway; GO:0097746 blood vessel diameter maintenance; GO:1900182 positive regulation of protein localization to nucleus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAKDLMEKGWNNHKKGKDCSKLGKKC
  • Length:  76(1-76)
  • Propeptide:  VVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAKDLMEKGWNNHKKGKDCSKLGKKC
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endothelins are endothelium-derived vasoconstrictor peptides (By similarity). Probable ligand for G-protein coupled receptors EDNRA and EDNRB which activates PTK2B, BCAR1, BCAR3 and, GTPases RAP1 and RHOA cascade in glomerular mesangial cells (By similari
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  EDNRA
  • Target Unid:  G7P6D6
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q28469-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q28469-F1.pdbhor006664_AF2.pdbhor006664_ESM.pdb

Physical Information

Mass: 996299 Formula: C368H609N117O108S7
Absent amino acids: I Common amino acids: K
pI: 10.32 Basic residues: 20
Polar residues: 24 Hydrophobic residues: 17
Hydrophobicity: -115.13 Boman Index: -21290
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 50.13
Instability Index: 3108.55 Extinction Coefficient cystines: 12865
Absorbance 280nm: 171.53

Literature

  • PubMed ID:  8964809
  • Title:  Increased expression of endothelin B receptor mRNA following subarachnoid hemorrhage in monkeys.